Applications: |
Immunodepletion/Immunocompetition |
Note: |
STRICTLY FOR FURTHER SCIENTIFIC RESEARCH USE ONLY (RUO). MUST NOT TO BE USED IN DIAGNOSTIC OR THERAPEUTIC APPLICATIONS. |
Short Description: |
Adenine Nucleotide Translocator 2 Blocking Peptide is synthetically produced from the 150-200 sequence and is suitable for use in western blot applications. |
Formulation: |
Liquid form at 2.5mg/ml concentration in PBS. Up to 5% DMSO can be added. Orders with >1mg can be supplied in lyophilized powder form, or in buffer of choice. |
Storage Instruction: |
Store at-20°C for long term storage. Avoid freeze-thaw cycles. |
Gene Symbol: |
SLC25A5 |
Gene ID: |
292 |
Uniprot ID: |
ADT2_HUMAN |
Immunogen Region: |
150-200 |
Immunogen: |
Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2. Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK |
Tissue Specificity | Expressed in erythrocytes (at protein level). |
Post Translational Modifications | Trimethylated by ANTKMT at Lys-52. |
Function | ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane. In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A5/ANT2 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as cofactor, but does not transport it. Probably mediates mitochondrial uncoupling in tissues that do not express UCP1. Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death. It is however unclear if SLC25A5/ANT2 constitutes a pore-forming component of mPTP or regulates it. Acts as a regulator of mitophagy independently of ADP:ATP antiporter activity: promotes mitophagy via interaction with TIMM44, leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation. |
Peptide Name | Adp/Atp Translocase 2Adp -Atp Carrier Protein 2Adp -Atp Carrier Protein - Fibroblast IsoformAdenine Nucleotide Translocator 2Ant 2Solute Carrier Family 25 Member 5 Cleaved Into - Adp/Atp Translocase 2 - N-Terminally Processed |
Database Links | Reactome: R-HSA-180897Reactome: R-HSA-83936 |
Cellular Localisation | Mitochondrion Inner MembraneMulti-Pass Membrane ProteinMembraneMay Localize To Non-Mitochondrial Membranes |
Alternative Peptide Names | Adp/Atp Translocase 2 proteinAdp -Atp Carrier Protein 2 proteinAdp -Atp Carrier Protein - Fibroblast Isoform proteinAdenine Nucleotide Translocator 2 proteinAnt 2 proteinSolute Carrier Family 25 Member 5 Cleaved Into - Adp/Atp Translocase 2 - N-Terminally Processed proteinSLC25A5 proteinAAC2 proteinANT2 protein |
Information sourced from Uniprot.org
12 months for antibodies. 6 months for ELISA Kits. Please see website T&Cs for further guidance