Adenine Nucleotide Translocator 2 Blocking Peptide peptide (STJ503646)

SKU:
STJ503646-250
$359.49
Free Shipping
Processing The item has been added

Short Description :Adenine Nucleotide Translocator 2 Blocking Peptide is synthetically produced from the 150-200 sequence and is suitable for use in western blot applications.
Applications:Immunodepletion/Immunocompetition
Note:STRICTLY FOR FURTHER SCIENTIFIC RESEARCH USE ONLY (RUO). MUST NOT TO BE USED IN DIAGNOSTIC OR THERAPEUTIC APPLICATIONS.
Formulation:Liquid form at 2.5mg/ml concentration in PBS. Up to 5% DMSO can be added. Orders with >1mg can be supplied in lyophilized powder form, or in buffer of choice.
Storage Instruction:Store at-20°C for long term storage. Avoid freeze-thaw cycles.
Gene Symbol:SLC25A5
Gene ID:292
Uniprot ID:ADT2_HUMAN
Immunogen:Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2. Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Immunogen Region:150-200
Tissue Specificity Expressed in erythrocytes (at protein level).
Post Translational Modifications Trimethylated by ANTKMT at Lys-52.
Function ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane. In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A5/ANT2 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as cofactor, but does not transport it. Probably mediates mitochondrial uncoupling in tissues that do not express UCP1. Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death. It is however unclear if SLC25A5/ANT2 constitutes a pore-forming component of mPTP or regulates it. Acts as a regulator of mitophagy independently of ADP:ATP antiporter activity: promotes mitophagy via interaction with TIMM44, leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.
Peptide Name Adp/Atp Translocase 2
Adp -Atp Carrier Protein 2
Adp -Atp Carrier Protein - Fibroblast Isoform
Adenine Nucleotide Translocator 2
Ant 2
Solute Carrier Family 25 Member 5 Cleaved Into - Adp/Atp Translocase 2 - N-Terminally Processed
Database Links Reactome: R-HSA-180897
Reactome: R-HSA-83936
Reactome: R-HSA-9837999
Cellular Localisation Mitochondrion Inner Membrane
Multi-Pass Membrane Protein
Membrane
May Localize To Non-Mitochondrial Membranes
Alternative Peptide Names Adp/Atp Translocase 2 protein
Adp -Atp Carrier Protein 2 protein
Adp -Atp Carrier Protein - Fibroblast Isoform protein
Adenine Nucleotide Translocator 2 protein
Ant 2 protein
Solute Carrier Family 25 Member 5 Cleaved Into - Adp/Atp Translocase 2 - N-Terminally Processed protein
SLC25A5 protein
AAC2 protein
ANT2 protein

Information sourced from Uniprot.org