| Host: | Rabbit |
| Applications: | ICC/WB |
| Reactivity: | Human/Mouse |
| Note: | STRICTLY FOR FURTHER SCIENTIFIC RESEARCH USE ONLY (RUO). MUST NOT TO BE USED IN DIAGNOSTIC OR THERAPEUTIC APPLICATIONS. |
| Short Description : | Rabbit polyclonal anti-Presenilin 2 loop region (C-Term) for use in ICC and WB in Human and Mouse samples. Datasheet included with dilution recommendations, and related reagents. |
| Clonality : | Polyclonal |
| Conjugation: | Unconjugated |
| Isotype: | IgG |
| Formulation: | Lyophilized from PBS, pH 7.4. Contains no preservative. |
| Purification: | IgG |
| Dilution Range: | WB 0.73611111111111116IP 0.1111111111111111 |
| Storage Instruction: | Spin vial briefly before opening. Reconstitute in 500 µL sterile-filtered 1X PBS, pH 7.2-7.6. Centrifuge to remove any insoluble material. Short term storage at 2-8°C for one week. At-20°C as an undiluted liquid for up to 12 months. |
| Gene Symbol: | PSEN2 |
| Gene ID: | 5664 |
| Uniprot ID: | PSN2_HUMAN |
| Immunogen Region: | C-Term |
| Specificity: | Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1. |
| Immunogen: | A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid. |
| Immunogen Sequence: | Human |
| Tissue Specificity | Isoform 1 is seen in the placenta, skeletal muscle and heart while isoform 2 is seen in the heart, brain, placenta, liver, skeletal muscle and kidney. |
| Post Translational Modifications | Heterogeneous proteolytic processing generates N-terminal and C-terminal fragments. Phosphorylated on serine residues. |
| Function | Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins. The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic reticulum to cytosol and is involved in calcium homeostasis. Is a regulator of mitochondrion-endoplasmic reticulum membrane tethering and modulates calcium ions shuttling between ER and mitochondria. |
| Protein Name | Presenilin-2Ps-2Ad3lpAd5E5-1Stm-2 Cleaved Into - Presenilin-2 Ntf Subunit - Presenilin-2 Ctf Subunit |
| Database Links | Reactome: R-HSA-1251985Reactome: R-HSA-193692Reactome: R-HSA-205043Reactome: R-HSA-2122948Reactome: R-HSA-2644606Reactome: R-HSA-2894862Reactome: R-HSA-2979096Reactome: R-HSA-3928665Reactome: R-HSA-9013507Reactome: R-HSA-9013700Reactome: R-HSA-9017802Reactome: R-HSA-9839383 |
| Cellular Localisation | Endoplasmic Reticulum MembraneMulti-Pass Membrane ProteinGolgi Apparatus Membrane |
| Alternative Antibody Names | Anti-Presenilin-2 antibodyAnti-Ps-2 antibodyAnti-Ad3lp antibodyAnti-Ad5 antibodyAnti-E5-1 antibodyAnti-Stm-2 Cleaved Into - Presenilin-2 Ntf Subunit - Presenilin-2 Ctf Subunit antibodyAnti-PSEN2 antibodyAnti-AD4 antibodyAnti-PS2 antibodyAnti-PSNL2 antibodyAnti-STM2 antibody |
Information sourced from Uniprot.org
